DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and nkx2.2b

DIOPT Version :10

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:92 Identity:38/92 - (41%)
Similarity:54/92 - (58%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKL 499
            |.|..|.|:..:||:.|...:   |::..|||:..|..||..|.|.||:.|.|.:||:.|||..|
Zfish    67 PSASPEELNPELSADESVDRE---SSEDSGKKRKRRILFSKTQTFELERRFRQQRYLSAPEREHL 128

  Fly   500 AYALGMSESQVKVWFQNRRTKWRKRHA 526
            |..|.::.:|||:||||.|.|.::..|
Zfish   129 AKLLHLTPTQVKIWFQNHRYKVKRARA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 28/57 (49%)
nkx2.2bNP_001007783.2 Homeodomain 96..152 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.