DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001008061.1 Gene:dlx2 / 493423 XenbaseID:XB-GENE-852891 Length:285 Species:Xenopus tropicalis


Alignment Length:273 Identity:66/273 - (24%)
Similarity:112/273 - (41%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SHSPNSHLISDRGSGGSSSSSSTTTTN----TNSQ-----GAPNPHGIDTILSKPPPVTSAGLSA 380
            :|.|:|...|...|..|.:...:|.|:    ||.|     ||.:|:|            ..|...
 Frog    15 NHMPSSSYHSLHKSQESPTLPVSTATDSSYYTNQQQQQHCGAGSPYG------------QLGSYQ 67

  Fly   381 LTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNT 445
            ..||.:...|.:..:..:....|.|...|..|                              |.:
 Frog    68 FHGAALNGISYSTKSYDLTYSGSYSSYGPYGT------------------------------SPS 102

  Fly   446 MSANLSQSHQHHPS----NDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMS 506
            ...|..:.....|.    |.|..|.:..|..:|..|:.||::.|::|:|||.||||:||.:||::
 Frog   103 PPHNDPEKEDCEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLT 167

  Fly   507 ESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQNKRCR 571
            ::|||:||||||:|::|.    ..:.:...|.:...::.....:..:...:.|.|    .::|.:
 Frog   168 QTQVKIWFQNRRSKFKKM----WKSGEIPSDQLPVGSESPTCNSPPASTATWDFG----PHQRLQ 224

  Fly   572 SNSSGSSQQQQDN 584
            ..:|||:.|..::
 Frog   225 GAASGSALQSSNS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 18/71 (25%)
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx2NP_001008061.1 DLL_N 29..107 CDD:315147 19/119 (16%)
Homeobox 130..183 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.