DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and MSX1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:276 Identity:67/276 - (24%)
Similarity:114/276 - (41%) Gaps:77/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PLAALHSMTTEMK------GQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNS 354
            |.|.:.|:...:|      |:..||.:                    |...|:::::......:.
Human     3 PAADMTSLPLGVKVEDSAFGKPAGGGA--------------------GQAPSAAAATAAAMGADE 47

  Fly   355 QGA-----PN--PHGIDTILS---KPPPVTSA-----GLSALTGA----GIPRFSIAAAAA---- 396
            :||     |:  |..::.:::   ||....||     |:.|..|:    |:|..|:.|..|    
Human    48 EGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSP 112

  Fly   397 ------GMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQ--- 452
                  .:...|...:.|.:|..:....:||    |.:|.         .|.|...:..||.   
Human   113 RPLGHFSVGGLLKLPEDALVKAESPEKPERT----PWMQS---------PRFSPPPARRLSPPAC 164

  Fly   453 SHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNR 517
            :.:.|.:|.|      .|..|:..|:.|||:.|.|.:||:..|||:.:.:|.::|:|||:|||||
Human   165 TLRKHKTNRK------PRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNR 223

  Fly   518 RTKWRKRHAAEMATAK 533
            |.|.::...||:...|
Human   224 RAKAKRLQEAELEKLK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 21/116 (18%)
Homeobox 469..523 CDD:395001 25/53 (47%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 7/56 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117 12/47 (26%)
PTZ00449 <105..>248 CDD:185628 44/154 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 11/53 (21%)
Homeobox 175..229 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.