DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx5

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:218 Identity:56/218 - (25%)
Similarity:90/218 - (41%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 GAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANL-----------SQSHQHH--- 457
            ||....|.|:....:..|     |...|...::....|..:.|.           |..|.||   
 Frog    46 GAAGHPHHGYCSPTSATY-----GKALNAYQYQYHGMNGAAGNYPGKAYSDYGYGSPYHPHHQYS 105

  Fly   458 --------PS---------------NDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKL 499
                    ||               |.|..|.:..|..:|..|:.||::.|::|:|||.||||:|
 Frog   106 GAYNRVQPPSSQPEKEVSEPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQKTQYLALPERAEL 170

  Fly   500 AYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESP 564
            |.:||::::|||:||||:|:|.:|         ..|..::..::....|:.|..::....:...|
 Frog   171 AASLGLTQTQVKIWFQNKRSKIKK---------IMKNGELPPEHSPSSSDPMACNSPQSPVVWEP 226

  Fly   565 AQNKRCRSN---------SSGSS 578
            ..:.|..|:         :||||
 Frog   227 QGSSRSLSHHPHVHSHPQASGSS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 27/53 (51%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 15/76 (20%)
Homeobox 140..193 CDD:306543 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.