Sequence 1: | NP_001368954.1 | Gene: | HGTX / 53446 | FlyBaseID: | FBgn0040318 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004778.1 | Gene: | dlx5 / 447997 | XenbaseID: | XB-GENE-853057 | Length: | 289 | Species: | Xenopus tropicalis |
Alignment Length: | 218 | Identity: | 56/218 - (25%) |
---|---|---|---|
Similarity: | 90/218 - (41%) | Gaps: | 60/218 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 407 GAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANL-----------SQSHQHH--- 457
Fly 458 --------PS---------------NDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKL 499
Fly 500 AYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESP 564
Fly 565 AQNKRCRSN---------SSGSS 578 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HGTX | NP_001368954.1 | ROM1 | 179..>388 | CDD:227709 | |
Homeobox | 469..523 | CDD:395001 | 27/53 (51%) | ||
dlx5 | NP_001004778.1 | DLL_N | 26..118 | CDD:315147 | 15/76 (20%) |
Homeobox | 140..193 | CDD:306543 | 27/52 (52%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |