DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and bap

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:117/258 - (45%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 GSSASANGLSYS----HSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGI------DTILS 368
            |.||:..|||.|    .|.|..|         :.|:..|...::....|.|..:      :..:|
  Fly     8 GVSAAMAGLSKSLTTPFSINDIL---------TRSNPETRRMSSVDSEPEPEKLKPSSDRERSIS 63

  Fly   369 KPPPV--TSAGLSALTGAGIPRFSIAAAAAGMAQYLS-------------QSQGAPLKTHAGHIV 418
            |.||:  ...||..||.   |: .|..:|...:.||.             |:.|.. .:.|...:
  Fly    64 KSPPLCCRDLGLYKLTQ---PK-EIQPSARQPSNYLQYYAAAMDNNNHHHQATGTS-NSSAADYM 123

  Fly   419 DRTHLYWPGLQGLVANPIAWRERLSNTMSAN----LSQSHQHHP-SNDKDG--KKKHTRPTFSGQ 476
            .|...|:   ...:|.|:..|...||....:    ||.|....| |:|..|  :||.:|..||..
  Fly   124 QRKLAYF---GSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHA 185

  Fly   477 QIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKR-----HAAEMATAKR 534
            |:|.||:.|.|.:||:||||:::|.:|.::|:|||:||||||.|.:::     .||.:..:||
  Fly   186 QVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 22/85 (26%)
Homeobox 469..523 CDD:395001 28/53 (53%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442244
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.