DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and CG15696

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:193 Identity:51/193 - (26%)
Similarity:81/193 - (41%) Gaps:51/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 TSAGLSAL--TGAGIPRFSIAAAAAGMAQYLSQSQGA--PLKTHAGHI-----VDRTHLYWPGLQ 429
            |:|.|..|  ..|.:|....|..|:    |:|:..|.  |.......|     :..|..:.|.| 
  Fly    20 TNASLGVLQRLRASLPFHPYAHPAS----YVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKL- 79

  Fly   430 GLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGP 494
                 |.|.|               |:.|:....|:.  .|..|:.||:.|||..::::.||:..
  Fly    80 -----PRALR---------------QNAPAKRTPGRL--PRIPFTPQQLQALENAYKESNYLSAE 122

  Fly   495 ERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNES 557
            :..|||.:|.::.::||:||||||.:.|:.        ||::|:       .|..|..|:..|
  Fly   123 DANKLADSLELTNTRVKIWFQNRRARERRE--------KREKDE-------SCDSTFSSNASS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 5/15 (33%)
Homeobox 469..523 CDD:395001 21/53 (40%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I3587
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.