DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and pb

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:291 Identity:72/291 - (24%)
Similarity:114/291 - (39%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 GVGGSSASANGLSYSHS-----PNSHLISDRGSGGSSSSSSTTTTNTNSQGA-----PNPHGIDT 365
            ||||...|.........     |:..:::.........|:.|....|.|:|.     |:......
  Fly    48 GVGGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLN 112

  Fly   366 ILSKPPPV--TSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGL 428
            .||...|.  |..|..|:.|.|:          .:...:....|.|:     .:|.:|.   .|:
  Fly   113 HLSPESPKIGTPVGSGAIGGVGV----------NVNVNVGVGVGYPV-----GVVPQTP---DGM 159

  Fly   429 QGLVANPIAWRERLSNTMSANLSQSH----QHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTK 489
            ..:...|....::.|...|.|.:|..    :..|.|   |..:..|..::..|:..|||.|...|
  Fly   160 DSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPEN---GLPRRLRTAYTNTQLLELEKEFHFNK 221

  Fly   490 YLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSD 554
            ||..|.|.::|.:|.::|.||||||||||.| .||........:..:|.:.||:|.  |::..:.
  Fly   222 YLCRPRRIEIAASLDLTERQVKVWFQNRRMK-HKRQTLSKTDDEDNKDSLKGDDDQ--SDSNSNS 283

  Fly   555 NESLDMGESPA-------QNKRCRSNSSGSS 578
            .:|....|.|:       .|.|..:|::.|:
  Fly   284 KKSCQGCELPSDDIPDSTSNSRGHNNNTPSA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 20/88 (23%)
Homeobox 469..523 CDD:395001 25/53 (47%)
pbNP_476669.3 COG5576 168..274 CDD:227863 36/109 (33%)
Homeobox 202..254 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.