DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and cdx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_989416.1 Gene:cdx1 / 395055 XenbaseID:XB-GENE-485396 Length:262 Species:Xenopus tropicalis


Alignment Length:262 Identity:69/262 - (26%)
Similarity:99/262 - (37%) Gaps:62/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIP 387
            ||.|.|..:.....|..|.:.||.|.     |:...:|:|       |.|    |.|:...|.| 
 Frog    42 SYHHVPGINSDPHHGQPGGTWSSYTP-----SREDWHPYG-------PGP----GASSANPAQI- 89

  Fly   388 RFS------IAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTM 446
            .||      :.....|:......|..:||...|    .|.:||            .|..|.....
 Frog    90 SFSPSDYNPVQPPGPGLLPPSLNSSVSPLSPSA----QRRNLY------------EWMRRTGVPT 138

  Fly   447 SANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVK 511
            |.|         ||.|...|...|..::..|...|||.|..::|:....:|:||.:|.::|.|||
 Frog   139 STN---------SNGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAASLALTERQVK 194

  Fly   512 VWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQNKRCRSNSSG 576
            :||||||.|.||.:..:|....::           .|.|..:..   .:|.:......|.|:||.
 Frog   195 IWFQNRRAKERKVNKKKMQQQSQQ-----------ASTTTPTPP---SVGTTAGMGGLCSSSSSN 245

  Fly   577 SS 578
            |:
 Frog   246 SN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 18/64 (28%)
Homeobox 469..523 CDD:395001 22/53 (42%)
cdx1NP_989416.1 Caudal_act 13..133 CDD:282574 29/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..120 24/94 (26%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 152..173 6/20 (30%)
Homeobox 153..205 CDD:278475 22/51 (43%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 191..202 8/10 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..262 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.