DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and msx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001032329.1 Gene:msx1 / 394692 XenbaseID:XB-GENE-490378 Length:275 Species:Xenopus tropicalis


Alignment Length:202 Identity:58/202 - (28%)
Similarity:84/202 - (41%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 LSKPPPVT--SAGLSALTG------AGIPRFSIAAAAA----GMAQYLSQSQGAPL--KTHAGHI 417
            :.:.|.|.  ..||....|      .||..||:.|..|    |..:.||...|:||  .:|:..:
 Frog    16 VEESPSVNKMQTGLKVALGEDKPKVPGILPFSVEALMADRKPGRERDLSSPTGSPLAGTSHSPRV 80

  Fly   418 VDRTHLYWPGLQGLVAN--PIAW--------------RERLSNTMSANLSQSHQHHPSNDKDGKK 466
            ........|.....:.|  |:..              .||.|...|...|.|.....|......:
 Frog    81 GSLAPGETPNSPISIGNRFPVGGIMKLPEEALVKPESPERSSWIQSPRFSPSPTRRMSPPACTLR 145

  Fly   467 KH-----TRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHA 526
            ||     .|..|:..|:.|||:.|.|.:||:..|||:.:.:|.::|:|||:||||||.|.::...
 Frog   146 KHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQE 210

  Fly   527 AEMATAK 533
            ||:...|
 Frog   211 AELEKLK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 7/28 (25%)
Homeobox 469..523 CDD:395001 25/53 (47%)
msx1NP_001032329.1 PTZ00449 <55..>259 CDD:185628 47/163 (29%)
Homeobox 153..207 CDD:365835 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.