DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and emx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_937787.1 Gene:emx1 / 378964 ZFINID:ZDB-GENE-031007-7 Length:231 Species:Danio rerio


Alignment Length:208 Identity:63/208 - (30%)
Similarity:88/208 - (42%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 IDTILSKPPPVT-------------SAGLSALTGAGIPRFSIAAAAAGMAQY------LSQS-QG 407
            |:::::|..|:|             :...|.|.|...|        ||.|.|      .|:: ..
Zfish    12 IESLVAKESPITLEDPIRPTALSYSAPADSFLNGYQSP--------AGRALYPNPELVFSETVNH 68

  Fly   408 APLKTHAGHIVDRTHLYWPGLQG------LVANPIAWRERL------SNTMSANLSQSHQHHPSN 460
            |||..|. |.:....|..|...|      |...|...|.|.      .|.:|.:....|..... 
Zfish    69 APLSMHP-HQLGSAPLQHPHFFGTQHREPLNFYPWVLRNRFFGHRFQGNDVSQDTLLLHGPFAR- 131

  Fly   461 DKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRH 525
                |.|..|..||..|:..||:.||:..|:.|.||.:||.:|.:||:||||||||||||::::.
Zfish   132 ----KPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANSLSLSETQVKVWFQNRRTKYKRQK 192

  Fly   526 AAE---MATAKRK 535
            ..|   ..|.|:|
Zfish   193 LEEEGPECTQKKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 7/37 (19%)
Homeobox 469..523 CDD:395001 29/53 (55%)
emx1NP_937787.1 COG5576 82..>192 CDD:227863 41/114 (36%)
Homeobox 137..189 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.