DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and vax2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:252 Identity:58/252 - (23%)
Similarity:87/252 - (34%) Gaps:101/252 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SHSPNSHLISDRGSGGSS-----------SSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGL 378
            :|..::.|..|||....|           ||:.|..|:.::..:.:..|.|.:|...|...    
Zfish    17 NHCGSNSLCRDRGRESKSRTEVGNRSPVQSSTDTPGTSASTPTSSSEDGHDKLLGVDPDYC---- 77

  Fly   379 SALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLS 443
                     |..:...|.|..:.:...:|..|        ||                       
Zfish    78 ---------RRILVRDAKGTIREIVLPKGLDL--------DR----------------------- 102

  Fly   444 NTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSES 508
                                  .|.||.:|:.:|::.||..|::.:|:.|.||.:||..|.:||:
Zfish   103 ----------------------PKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSET 145

  Fly   509 QVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPA 565
            ||||||||||||.:|                        .:|.|:|..|....||.|
Zfish   146 QVKVWFQNRRTKQKK------------------------DQTKDTDKRSSSTSESLA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 14/73 (19%)
Homeobox 469..523 CDD:395001 28/53 (53%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/52 (23%)
Homeobox 106..159 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.