DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx2-4

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_038962557.1 Gene:Nkx2-4 / 366213 RGDID:1304985 Length:353 Species:Rattus norvegicus


Alignment Length:226 Identity:60/226 - (26%)
Similarity:93/226 - (41%) Gaps:52/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 TNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAA-----GMAQYLSQSQGAP 409
            |..:||.|       .:....||...||.:|...|.....:.||||.     |::|:...:.|:.
  Rat    52 TGPSSQAA-------AVAGMQPPHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHSAMGSY 109

  Fly   410 LKTHAGHIVDRTHLYWPGLQ-GLVANPIAW--------RERLSNTM------------------- 446
            .....|: :.....|..|:: |..|....|        ...:|..|                   
  Rat   110 CNGGLGN-MGELPAYTDGMRGGAAAAATGWYGANTDPRYSSISRFMGPSAGVNVAGMGSLTGIAD 173

  Fly   447 -SANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQV 510
             :.:|:..|...|       ::..|..||..|::.||:.|:|.|||:.|||..||..:.::.:||
  Rat   174 AAKSLAPLHAAAP-------RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQV 231

  Fly   511 KVWFQNRRTKWRKRHAAEMATAKRKQDDMGG 541
            |:||||.|.| .||.|.:.|..:.:|:  ||
  Rat   232 KIWFQNHRYK-MKRQAKDKAAQQLQQE--GG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 10/37 (27%)
Homeobox 469..523 CDD:395001 25/53 (47%)
Nkx2-4XP_038962557.1 Homeobox 190..244 CDD:395001 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.