DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and NOTO

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001127934.1 Gene:NOTO / 344022 HGNCID:31839 Length:251 Species:Homo sapiens


Alignment Length:262 Identity:72/262 - (27%)
Similarity:108/262 - (41%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 SPNSHLISDRGSGGSSSSSSTTTTNTNSQGAP----NPHGIDTILSKPPPV-------------- 373
            :|:...:....||.|.:..|.|..||  ..||    :|..::.||::|.|.              
Human    13 APSGSRVRPPRSGRSPAPRSPTGPNT--PRAPGRFESPFSVEAILARPDPCAPAASQPSGSACVH 75

  Fly   374 ----TSAGLSALTGAGIPRFSIAAAAAGMAQYLSQS-------QGAPLKTHAGHIVDRTHLYWPG 427
                |:|.|.| || |:|   .|...:.:..|||..       :.||:....|..|  |.|....
Human    76 PAFWTAASLCA-TG-GLP---WACPTSWLPAYLSVGFYPVPGPRVAPVCGLLGFGV--TGLELAH 133

  Fly   428 LQGLVANPIAW--RERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKY 490
            ..||.|.| .|  .|.|.:|                 :.::|..|..|:.:|:..|||.|.:...
Human   134 CSGLWAFP-DWAPTEDLQDT-----------------ERQQKRVRTMFNLEQLEELEKVFAKQHN 180

  Fly   491 LAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDN 555
            |.|.:||:||..|.::|:||:|||||||.|::|:.....|....:...:...:....:.....|.
Human   181 LVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDA 245

  Fly   556 ES 557
            ||
Human   246 ES 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 22/82 (27%)
Homeobox 469..523 CDD:395001 25/53 (47%)
NOTONP_001127934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 10/35 (29%)
Homeobox 160..211 CDD:278475 24/50 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..251 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.