DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and TLX2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:287 Identity:87/287 - (30%)
Similarity:109/287 - (37%) Gaps:91/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GNPGCHNNNNHMDHKLPLSF------LGPPLAALHSMTTEMKGQGVG-GSSASANGLSYSHSPNS 330
            |..|.||    :.|..|:||      .||          |..|.|:| |.....:|.:.:.|...
Human     4 GMLGPHN----LPHHEPISFGIDQILSGP----------ETPGGGLGLGRGGQGHGENGAFSGGY 54

  Fly   331 HLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTI-----LSKPPPVTSA----GLSALTGAGI 386
            |..|..|..||.:..      ..|.|. .|.|:..:     |..|||...|    |.|.|.||| 
Human    55 HGASGYGPAGSLAPL------PGSSGV-GPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAG- 111

  Fly   387 PRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAW--------RERLS 443
                                                    ||.||.   ..|        ::||:
Human   112 ----------------------------------------GLAGLT---FPWMDSGRRFAKDRLT 133

  Fly   444 NTMSANLSQSHQHHP-SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSE 507
            ..:|.........|| .|....|:|..|.:||..|:..||:.|.:.||||..|||.||.||.|::
Human   134 AALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTD 198

  Fly   508 SQVKVWFQNRRTKWRKRHAAEMATAKR 534
            :|||.|||||||||| |..||...|:|
Human   199 AQVKTWFQNRRTKWR-RQTAEEREAER 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 37/130 (28%)
Homeobox 469..523 CDD:395001 31/53 (58%)
TLX2NP_057254.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 16/59 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..166 7/26 (27%)
Homeobox 160..213 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.