DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx2-3

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:130 Identity:39/130 - (30%)
Similarity:62/130 - (47%) Gaps:32/130 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 IAWRERLSNTMSANLSQSHQHHPSND----KDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPER 496
            ::.|.:.|..:..:|..:.....|.|    |...::..|..||..|:|.||:.|:|.:||:.|||
  Rat   111 VSERSQKSCQLKKSLEAAGDCKASEDGERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPER 175

  Fly   497 AKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMG 561
            ..||.:|.::.:|||:||||||.|           .||::.|                 :||::|
  Rat   176 EHLASSLKLTSTQVKIWFQNRRYK-----------CKRQRQD-----------------KSLELG 212

  Fly   562  561
              Rat   213  212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 27/53 (51%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.