powered by:
Protein Alignment HGTX and Nkx2-3
DIOPT Version :9
Sequence 1: | NP_001368954.1 |
Gene: | HGTX / 53446 |
FlyBaseID: | FBgn0040318 |
Length: | 587 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101064.1 |
Gene: | Nkx2-3 / 309389 |
RGDID: | 1308521 |
Length: | 362 |
Species: | Rattus norvegicus |
Alignment Length: | 130 |
Identity: | 39/130 - (30%) |
Similarity: | 62/130 - (47%) |
Gaps: | 32/130 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 436 IAWRERLSNTMSANLSQSHQHHPSND----KDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPER 496
::.|.:.|..:..:|..:.....|.| |...::..|..||..|:|.||:.|:|.:||:.|||
Rat 111 VSERSQKSCQLKKSLEAAGDCKASEDGERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPER 175
Fly 497 AKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETMDSDNESLDMG 561
..||.:|.::.:|||:||||||.| .||::.| :||::|
Rat 176 EHLASSLKLTSTQVKIWFQNRRYK-----------CKRQRQD-----------------KSLELG 212
Fly 562 561
Rat 213 212
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HGTX | NP_001368954.1 |
ROM1 |
179..>388 |
CDD:227709 |
|
Homeobox |
469..523 |
CDD:395001 |
27/53 (51%) |
Nkx2-3 | NP_001101064.1 |
Homeobox |
148..202 |
CDD:395001 |
27/64 (42%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.