DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx6-2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001101028.1 Gene:Nkx6-2 / 309095 RGDID:1307280 Length:277 Species:Rattus norvegicus


Alignment Length:298 Identity:130/298 - (43%)
Similarity:158/298 - (53%) Gaps:78/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 MDHKLPLSFL--GPPLAALHSMTTEMKG-------QGVGGSSASANGLSYSHSPNSHLISDRGSG 339
            ||...|.:|:  ..||||||:| .|||.       ||..|....|                .||.
  Rat     1 MDANRPGAFVLSSAPLAALHNM-AEMKTSLFPYALQGPAGFKTPA----------------LGSL 48

  Fly   340 GSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGM----AQ 400
            |:.....|            ||||..||.:|......||.    ..:||.:..|::||:    |.
  Rat    49 GAQLPLGT------------PHGISDILGRPVGAAGGGLL----GSLPRLNGLASSAGVYFGPAA 97

  Fly   401 YLSQSQGAPLKTHAGHIVDRTHLYWPG-LQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDG 464
            .:::....||....|    |..::||| :||   :|  ||:       ..|:.|.|.....||||
  Rat    98 AVARGYPKPLAELPG----RPPIFWPGVVQG---SP--WRD-------PRLAGSAQAGGVLDKDG 146

  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEM 529
            ||||:||||||||||||||||||||||||||||:|||:|||:|||||||||||||||||||||||
  Rat   147 KKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEM 211

  Fly   530 ATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQN 567
            |:||:||               |||.|.|.:|.|.|::
  Rat   212 ASAKKKQ---------------DSDAEKLKVGGSDAED 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 31/112 (28%)
Homeobox 469..523 CDD:395001 49/53 (92%)
Nkx6-2NP_001101028.1 Homeobox 151..205 CDD:395001 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5762
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001882
OrthoInspector 1 1.000 - - otm46415
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.