DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and nkx2.7

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:93 Identity:35/93 - (37%)
Similarity:56/93 - (60%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 TMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQ 509
            |.|:..|::.:......|...::..|..||..|:|.||:.|:|.:||:.|||..||.||.::.:|
Zfish   103 TDSSYSSKNGETLREKPKQRLRRKPRVLFSQTQVFELERRFKQQRYLSAPERDHLALALKLTSTQ 167

  Fly   510 VKVWFQNRRTKWRKRH---AAEMATAKR 534
            ||:||||||.|.:::.   :.|:|..:|
Zfish   168 VKIWFQNRRYKCKRQRQDKSLELAGPRR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 35/93 (38%)
Homeobox 127..180 CDD:278475 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.