DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx6a

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:118 Identity:41/118 - (34%)
Similarity:60/118 - (50%) Gaps:37/118 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 SNTMSANLSQ---SHQHH----PS------------------------------NDKDGKKKHTR 470
            ||:.:.:|..   ||.||    ||                              |.|..|.:..|
Zfish    65 SNSYNRSLPYSYVSHPHHSPYLPSYHSNASGTQTRLDATEQQKTTVIENGEIRFNGKGKKIRKPR 129

  Fly   471 PTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            ..:|..|:.||...|:||:|||.||||:||.:||::::|||:||||:|:|::|
Zfish   130 TIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK 182

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)