DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx4b

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:288 Identity:66/288 - (22%)
Similarity:99/288 - (34%) Gaps:122/288 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 SQRAKFQHHHGVNPLALHNANHAGN----PGCHNNNNHMDHKLPLSFLGP----PLAALHSMTTE 306
            |:.|..:..||:.....|.:..|.|    .|.| :..|:.|..|.....|    ||...:.    
Zfish    17 SKSAFLEFGHGLASNQQHLSGFAHNIYPVHGLH-SGGHLQHDAPYPSSAPHYSRPLGYAYP---- 76

  Fly   307 MKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPP 371
                  |..||:|.|....:.||:|         |.:.:.|...:||.:             ||.
Zfish    77 ------GPVSAAAPGAYMPYQPNNH---------SGALAHTRAEDTNHE-------------KPA 113

  Fly   372 PVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPI 436
            .:.:                                       |.|                   
Zfish   114 VIEN---------------------------------------GEI------------------- 120

  Fly   437 AWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAY 501
                ||                 |.|..|.:..|..:|..|:.||.:.|:||:|||.||||.||.
Zfish   121 ----RL-----------------NGKGKKIRKPRTIYSSVQLQALHQRFQQTQYLALPERADLAA 164

  Fly   502 ALGMSESQVKVWFQNRRTKWRK--RHAA 527
            .||::::|||:||||:|:|::|  :|.:
Zfish   165 KLGLTQTQVKIWFQNKRSKYKKIMKHGS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 29/145 (20%)
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.