DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx2a

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:278 Identity:69/278 - (24%)
Similarity:117/278 - (42%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 SMTTEMKGQGVGGSSASANGLSYS-HSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDT 365
            |::|:|....:  :|:|.:.|..| .||...:        |:::.|:...|.|.|.|.:|:|   
Zfish    10 SLSTDMHSNQI--TSSSYHSLHKSQESPTLPV--------STATDSSYYNNNNQQCAGSPYG--- 61

  Fly   366 ILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQG 430
                  .::|                       .||.:.|..:        :...|..|..|. |
Zfish    62 ------QISS-----------------------YQYQNNSMNS--------VQYNTKSYELGF-G 88

  Fly   431 LVANPIAWRERLSNTMSANLSQSHQHHPS----NDKDGKKKHTRPTFSGQQIFALEKTFEQTKYL 491
            ....|.......|:...|: ::..:..|.    |.|..|.:..|..:|..|:.||::.|::|:||
Zfish    89 NAFGPYGTYGSCSSPTPAD-AEKEESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYL 152

  Fly   492 AGPERAKLAYALGMSESQVKVWFQNRRTKWRK----------RHAAEMATAKRKQDDMGGDNDGD 546
            |.||||:||.:||::::|||:||||||:|::|          :|.|...:.......:....|..
Zfish   153 ALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKSGEIPPEQHVASSESPPHPSPPLAAAWDFA 217

  Fly   547 CSETMDSDNESLDMGESP 564
            .|:.|::.|..|.....|
Zfish   218 HSQRMNTVNSGLSQSSPP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 18/86 (21%)
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:289198 20/123 (16%)
Homeobox 130..183 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.