DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx1a

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571380.1 Gene:dlx1a / 30568 ZFINID:ZDB-GENE-990415-48 Length:252 Species:Danio rerio


Alignment Length:296 Identity:62/296 - (20%)
Similarity:99/296 - (33%) Gaps:121/296 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 ESASPPPQGQN---DYSPENLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHKLPLSF 292
            ||.:.|..|::   ::.|.:.....:...|.|    .::|         |.:::.|..|      
Zfish     8 ESLNSPVSGKSVFMEFGPPSQQMSPSSMTHGH----YSMH---------CLHSSGHPQH------ 53

  Fly   293 LGPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGA 357
                                  .||.:...|:..|.....::..||..||...||..|..|:...
Zfish    54 ----------------------DSAYSPAPSFPRSLPYPYVNSVGSHSSSPYLSTVQTYPNNSAL 96

  Fly   358 PNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTH 422
                 ..|.|..|.|.:..  :.:...|..||                                 
Zfish    97 -----AQTRLEDPAPESEK--NTVVEGGEVRF--------------------------------- 121

  Fly   423 LYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQ 487
                                                 |.|..|.:..|..:|..|:.||.:.|:|
Zfish   122 -------------------------------------NGKGKKIRKPRTIYSSLQLQALNRRFQQ 149

  Fly   488 TKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            |:|||.||||:||.:||::::|||:||||:|:|::|
Zfish   150 TQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 28/159 (18%)
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx1aNP_571380.1 COG5576 <124..233 CDD:227863 31/62 (50%)
Homeobox 131..184 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.