DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and emx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:323 Identity:76/323 - (23%)
Similarity:108/323 - (33%) Gaps:121/323 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 CQTSESA----SPPPQGQNDYSPENLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHK 287
            |.|.||.    :|.|..:::                ..:.|.||..||.                
Zfish     9 CFTIESLVAKDNPLPSSRSE----------------EPIRPAALSYANS---------------- 41

  Fly   288 LPLSFLGPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNT 352
               |.:.|.|...||     .|:||..:.......:.||.|||.:                    
Zfish    42 ---SQMNPFLNGFHS-----SGRGVYSNPGLVFAEAVSHPPNSAV-------------------- 78

  Fly   353 NSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHI 417
                        .:.|.|||...|                      |..||.|. :|....|...
Zfish    79 ------------PVHSVPPPHALA----------------------AHPLSSSH-SPHPLFASQQ 108

  Fly   418 VDRTHLY-WPGLQGLVANPIAWRER-LSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFA 480
            .|.:..| |          :..|.| |.:....|.:........|....|.|..|..||..|:..
Zfish   109 RDPSTFYPW----------LIHRYRYLGHRFQGNETSPESFLLHNALARKPKRIRTAFSPSQLLR 163

  Fly   481 LEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDN 543
            ||..||:..|:.|.||.:||::|.::|:||||||||||||::          ::|.::.|.|:
Zfish   164 LEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK----------RQKLEEEGSDS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 29/164 (18%)
Homeobox 469..523 CDD:395001 28/53 (53%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.