DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and emx3

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571354.1 Gene:emx3 / 30536 ZFINID:ZDB-GENE-990415-53 Length:233 Species:Danio rerio


Alignment Length:244 Identity:67/244 - (27%)
Similarity:96/244 - (39%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 GQGVGGSSASAN------GLSYSHS--PNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDT 365
            |:....|:|:|:      .|.::.|  |:......:.||.:..|||.....|:    |:.|.   
Zfish    16 GKDSNSSNAAADEPIRPTALRFTESIHPSPFGSCFQNSGRTLYSSSPEMMFTD----PSTHS--- 73

  Fly   366 ILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLY-WPGLQ 429
                    |::||| |....||               :|...:|      |..|..:.| |.   
Zfish    74 --------TNSGLS-LRHLQIP---------------TQPFFSP------HQRDTLNFYPWV--- 105

  Fly   430 GLVANPIAWRERLSNTMSANLSQSHQHHPSN-----DKDGKKKHTRPTFSGQQIFALEKTFEQTK 489
                        |.|....:..|.....|.|     ....|.|..|..||..|:..||:.||:..
Zfish   106 ------------LRNRYLGHRFQGDDSSPENLLLHGPFSRKPKRIRTAFSPSQLLRLERAFEKNH 158

  Fly   490 YLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMA---TAKRK 535
            |:.|.||.:||..|.::|:||||||||||||.:::...|.:   ..|||
Zfish   159 YVVGAERKQLANGLCLTETQVKVWFQNRRTKHKRQKLEEESPDPQQKRK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 21/86 (24%)
Homeobox 469..523 CDD:395001 28/53 (53%)
emx3NP_571354.1 Homeobox 139..191 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.