DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and msx1b

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571335.1 Gene:msx1b / 30511 ZFINID:ZDB-GENE-980526-26 Length:257 Species:Danio rerio


Alignment Length:224 Identity:59/224 - (26%)
Similarity:92/224 - (41%) Gaps:44/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPR----FSIAAA 394
            |.:|...::|...:.:.:..||             ||..:|     |.||....:    ||:.:.
Zfish     3 SPKGPVETTSQEKSESDSEESQ-------------KPRDMT-----ADTGHKAKKTYLPFSVESL 49

  Fly   395 AAGMAQYLSQSQGAPLKTH--AGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQ-- 455
            .|..:  ..|...:|...|  .||..|....|:.....:..:.::......|..|..||...|  
Zfish    50 MAKSS--CQQVACSPALQHQRMGHGQDLVRTYFVEKAKVSVDTLSSVSDSLNDDSEELSDKEQST 112

  Fly   456 -----------HHPSNDKDGKKKH-----TRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALG 504
                       .|||......:||     .|..||..|:.:||:.|.|.:||:..|||:.:.:|.
Zfish   113 WSNSSSFTSPPRHPSPTPCTLRKHKTNRKPRTPFSTSQLLSLERKFRQKQYLSIAERAEFSNSLN 177

  Fly   505 MSESQVKVWFQNRRTKWRKRHAAEMATAK 533
            ::|:|||:||||||.|.::...||:...|
Zfish   178 LTETQVKIWFQNRRAKAKRLQEAELEKFK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 11/53 (21%)
Homeobox 469..523 CDD:395001 25/53 (47%)
msx1bNP_571335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 11/51 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 11/54 (20%)
Homeobox 142..195 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.