DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx4

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:260 Identity:62/260 - (23%)
Similarity:98/260 - (37%) Gaps:87/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 PLSFLGP-----PLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTT 348
            ||..|||     |..|..|........|:...:|::..||:|.: ..||:|              
  Rat     7 PLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQT-YGHLLS-------------- 56

  Fly   349 TTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTH 413
                              .|.|.|.|...                      .|||..|.:...:.
  Rat    57 ------------------YSYPGPATPGD----------------------SYLSSQQQSAAPSR 81

  Fly   414 AGHIVDRTHLYWPGLQGLVANPIAWRERL---SNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSG 475
            ..|                 .|....:.|   |..::.:|..|   .||..:  |.:..|..:|.
  Rat    82 PFH-----------------QPTEHPQELEAESEKLALSLEPS---QPSLTR--KLRKPRTIYSS 124

  Fly   476 QQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMG 540
            .|:..|.:.|:.|:|||.||||:||..||::::|||:||||:|:|::|  ..:.::.:.::|..|
  Rat   125 LQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK--LLKQSSGELEEDFSG 187

  Fly   541  540
              Rat   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 20/103 (19%)
Homeobox 469..523 CDD:395001 26/53 (49%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.