DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx2-8

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001100202.1 Gene:Nkx2-8 / 299061 RGDID:1310629 Length:234 Species:Rattus norvegicus


Alignment Length:192 Identity:48/192 - (25%)
Similarity:69/192 - (35%) Gaps:68/192 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 QGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDG------------------------KKKHT 469
            |..|....||           |.....|:||:|:.|                        |::..
  Rat    31 QTCVPQTAAW-----------LESERSHYPSSDESGLETSPADSSQLASLGRASPGSDAEKRRKR 84

  Fly   470 RPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKR 534
            |..||..|...||:.|.|.:||:.|||.:||..|.::.:|||:||||.|.|.::..|..:     
  Rat    85 RVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGV----- 144

  Fly   535 KQDDMGGDNDGDCSETMDSD-NESLDMGESPAQNKR------------CRSNSSGSSQQQQD 583
                           |..|| ..|.|:..:|...:|            |.....|::...||
  Rat   145 ---------------TESSDVTASADLHAAPGLLRRVVVPVLVHDRSPCNGRGEGTAAVPQD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 25/53 (47%)
Nkx2-8NP_001100202.1 Homeobox 84..137 CDD:278475 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.