DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001094001.1 Gene:Dlx1 / 296500 RGDID:1309593 Length:255 Species:Rattus norvegicus


Alignment Length:193 Identity:60/193 - (31%)
Similarity:93/193 - (48%) Gaps:56/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 NSQGAPNP--HGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAP----LK 411
            |.|.:|:|  ||..::..    :.|||.|...||    :|.|::       .|:..|.|    :.
  Rat    27 NQQMSPSPMSHGHYSMHC----LHSAGHSQPDGA----YSSASS-------FSRPLGYPYVNSVS 76

  Fly   412 THAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKD------------- 463
            :||......:...:||                   ||:|:||....|..|.:             
  Rat    77 SHASSPYISSVQSYPG-------------------SASLAQSRLEDPGADSEKSTVVEGGEVRFN 122

  Fly   464 --GKK-KHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
              ||| :..|..:|..|:.||.:.|:||:|||.||||:||.:||::::|||:||||:|:|::|
  Rat   123 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 12/36 (33%)
Homeobox 469..523 CDD:395001 28/53 (53%)
Dlx1NP_001094001.1 Homeobox 131..185 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.