DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:308 Identity:84/308 - (27%)
Similarity:130/308 - (42%) Gaps:75/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 SMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTI 366
            |:..:|....:   :||:....:...|:.   :..||||||:|||:.:.....|.:|      |:
  Rat     7 SLVADMHSTQI---TASSTYHQHQQPPSG---AGAGSGGSSNSSSSNSNLHKPQESP------TL 59

  Fly   367 LSKPPPVTSAGLSAL----------TGAGIPRFSIAAAAAGMAQYLSQSQG-------APLKTHA 414
                 ||::|..|:.          .|.|      |:..|.|..|...:.|       |......
  Rat    60 -----PVSTATDSSYYTNQQHPAGGGGGG------ASPYAHMGSYQYHASGLNNVSYSAKSSYDL 113

  Fly   415 GHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPS----NDKDGKKKHTRPTFSG 475
            |:....|. |.|  .|..::|:           .|........|.    |.|..|.:..|..:|.
  Rat   114 GYTAAYTS-YAP--YGTSSSPV-----------NNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSS 164

  Fly   476 QQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKR-HAAEMATAKRKQDDM 539
            .|:.||::.|::|:|||.||||:||.:||::::|||:||||||:|::|. .:.|:.|    :...
  Rat   165 FQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPT----EQHP 225

  Fly   540 GGDNDGDCSETMDSDNESLDMGESPAQNKRC---------RSNSSGSS 578
            |......|:....|...|.|.|   ||.:..         .:.|||||
  Rat   226 GASASPPCASPPVSAPASWDFG---AQQRMAGGGPGSGGSGAGSSGSS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 23/95 (24%)
Homeobox 469..523 CDD:395001 28/53 (53%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 21/111 (19%)
Homeobox 158..211 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.