DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:262 Identity:65/262 - (24%)
Similarity:100/262 - (38%) Gaps:84/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 HKLPLSFLG------------PP--LAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDR 336
            ||:..|.|.            ||  ||||.:..:.::.: .|..:.|.|.:....:|      |.
  Rat    16 HKISFSVLDILDPQKFTRAALPPVRLAALEAKKSLVEVE-AGEDACSGNPIGSQETP------DA 73

  Fly   337 GSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQY 401
            ..||:..:|....:....:.                                   .|..||.||.
  Rat    74 VGGGTDPASPVEGSEAEEEE-----------------------------------EAEDAGRAQR 103

  Fly   402 LSQSQGAPLKTHAGHI--------VDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHP 458
            ..:.|||    |||.:        .:.:     |..||.|:|           .:..|...:...
  Rat   104 PERWQGA----HAGSLEAGAVAVGTEES-----GADGLPASP-----------GSPGSPRPRRRR 148

  Fly   459 SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            :.....|.:..|..|:.:|:.|||..|..|:||:..||..||.:|.::|:|||:|||||||||:|
  Rat   149 AESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK 213

  Fly   524 RH 525
            ::
  Rat   214 QN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 18/115 (16%)
Homeobox 469..523 CDD:395001 28/53 (53%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.