DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx2-1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_006240178.1 Gene:Nkx2-1 / 25628 RGDID:3866 Length:423 Species:Rattus norvegicus


Alignment Length:415 Identity:104/415 - (25%)
Similarity:151/415 - (36%) Gaps:111/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PPASSRLHSDSSPSPRYEHNSSP-GVDSAKSYALSQRSSGAEDPCQTSESASPPPQGQND-YSPE 246
            ||:   |||......|    |:| .|...:| |||:|...:..|..|:      |...:| .||.
  Rat    21 PPS---LHSSQLRRTR----STPLRVHPTRS-ALSRRRIMSMSPKHTT------PFSVSDILSPL 71

  Fly   247 NLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHKLPLSFLGPPLAALHSMTTEMKGQG 311
            ..|.::...:......|||.:....|..|......:.:.|.      |...||.|     |...|
  Rat    72 EESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHH------GAVTAAYH-----MTAAG 125

  Fly   312 VGGSSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSA 376
            |...|.||.| .|.   |.:|      |..|.......|..||...|..:|     :.|.     
  Rat   126 VPQLSHSAVG-GYC---NGNL------GNVSELPPYQDTMRNSASGPGWYG-----ANPD----- 170

  Fly   377 GLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRER 441
                      |||...:...|.|..::.|                     |:.||.:        
  Rat   171 ----------PRFPAISRFMGPASGMNMS---------------------GMGGLGS-------- 196

  Fly   442 LSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMS 506
                 ..::|::....||    ..::..|..||..|::.||:.|:|.|||:.|||..||..:.::
  Rat   197 -----LGDVSKNMAPLPS----APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLT 252

  Fly   507 ESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDG----DCSETMDSDNESLDMGESPA-- 565
            .:|||:||||.|.| .||.|.:.|..::.|.|.||...|    .|.:...:..:|......|.  
  Rat   253 PTQVKIWFQNHRYK-MKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLV 316

  Fly   566 -QNKRCRSNS--------SGSSQQQ 581
             ..|.|::.:        .|.:|||
  Rat   317 KDGKPCQAGAPAPGAASLQGHAQQQ 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 49/205 (24%)
Homeobox 469..523 CDD:395001 25/53 (47%)
Nkx2-1XP_006240178.1 Homeobox 215..268 CDD:278475 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.