Sequence 1: | NP_001368954.1 | Gene: | HGTX / 53446 | FlyBaseID: | FBgn0040318 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663755.2 | Gene: | Obox5 / 252829 | MGIID: | 2149035 | Length: | 291 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 83/205 - (40%) | Gaps: | 46/205 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 395 AAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPG--LQGLVANPIAWRERLSNTMSANLSQSHQHH 457
Fly 458 PSNDK----------DGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKV 512
Fly 513 WFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSET--------MDSDN-ESL---DMGESPA 565
Fly 566 QNKRCRSNSS 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HGTX | NP_001368954.1 | ROM1 | 179..>388 | CDD:227709 | |
Homeobox | 469..523 | CDD:395001 | 15/53 (28%) | ||
Obox5 | NP_663755.2 | homeodomain | 95..153 | CDD:238039 | 16/57 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |