DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Urad

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001034767.1 Gene:Urad / 231903 MGIID:3647519 Length:178 Species:Mus musculus


Alignment Length:132 Identity:23/132 - (17%)
Similarity:46/132 - (34%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 GHIVDRTHL----YW-----PGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTR 470
            |:||::..|    .|     .||:.|..:..|:.:.|..:....:.:.|                
Mouse    19 GNIVEKCPLIAAAVWSQRPFSGLEDLENHFFAFIDALPRSGQEGILRCH---------------- 67

  Fly   471 PTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRK 535
            |..:|:.:       :|....|..:|.:....|...::..::..|....::|:|.......|.|.
Mouse    68 PDLAGRDL-------QQGTLTAESQREQSQAGLTSLDTDDRLRLQQLNAQYRERFGFPFVLAARL 125

  Fly   536 QD 537
            .|
Mouse   126 SD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 7/53 (13%)
UradNP_001034767.1 OHCU_decarbox 10..162 CDD:286439 23/132 (17%)
Substrate binding. /evidence=ECO:0000250 84..88 1/3 (33%)
Substrate binding. /evidence=ECO:0000250 119..123 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.