DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Tlx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:278 Identity:84/278 - (30%)
Similarity:111/278 - (39%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 NHMDHKLPLSF------LGPPLAALHSMTTEMKGQGVG-GSSASANGLSYSHSPNSHLISDRGSG 339
            :|:.|..|:||      .||          |..|.|:| |.|..::|.|.:.|...|     |:.
Mouse     9 HHLPHHEPISFGIDQILSGP----------EPPGGGLGPGQSGQSHGESAAFSSGFH-----GAS 58

  Fly   340 GSSSSSSTTTTNTNSQGAPNPHGIDTI-----LSKPPPVTSA----GLSALTGAGIPRFSIAAAA 395
            |.:.:.|..:....|  ...|.|:..:     |..|||..:|    |.|.|.|||          
Mouse    59 GYAPAGSLASLPRGS--GVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAG---------- 111

  Fly   396 AGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAW--------RERLSNTMSANLSQ 452
                                           ||.||.   ..|        ::||:..:|.....
Mouse   112 -------------------------------GLAGLT---FPWMDSGRRFAKDRLTAALSPFSGT 142

  Fly   453 SHQHHP-SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQN 516
            ....|| .|....|:|..|.:||..|:..||:.|.:.||||..|||.||.||.|:::|||.||||
Mouse   143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQN 207

  Fly   517 RRTKWRKRHAAEMATAKR 534
            |||||| |..||...|:|
Mouse   208 RRTKWR-RQTAEEREAER 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 34/121 (28%)
Homeobox 469..523 CDD:395001 31/53 (58%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 7/25 (28%)
Homeobox 160..213 CDD:306543 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.