DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:255 Identity:65/255 - (25%)
Similarity:100/255 - (39%) Gaps:70/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 HKLPLSFLG------------PP--LAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDR 336
            ||:..|.|.            ||  ||||.:..: ::....|..:.|.|.:....:|::   ..|
Mouse    16 HKISFSVLDILDPQKFTRAALPPVRLAALEAKKS-LEEVEAGQDACSGNPIGSQETPDA---VGR 76

  Fly   337 G-SGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQ 400
            | ..||....|.......::.|...|       :|.          ...|:...|..|.|..:..
Mouse    77 GIDPGSPVEGSEAEEEEEAEDAGRAH-------QPE----------RWQGVHEGSPEARAVAVGT 124

  Fly   401 YLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGK 465
            ..|.::|.|..              ||..|   :|...|.|..::.:                 |
Mouse   125 EESGAEGLPAS--------------PGSPG---SPRPRRRRAESSCA-----------------K 155

  Fly   466 KKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRH 525
            .:..|..|:.:|:.|||..|..|:||:..||..||.:|.::|:|||:|||||||||:|::
Mouse   156 PRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 23/116 (20%)
Homeobox 469..523 CDD:395001 28/53 (53%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 26/160 (16%)
Homeobox 160..212 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.