DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and EMX1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_004088.2 Gene:EMX1 / 2016 HGNCID:3340 Length:290 Species:Homo sapiens


Alignment Length:236 Identity:71/236 - (30%)
Similarity:98/236 - (41%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPP--------PVTSAGLSALTGAGI 386
            |.:..|.|:||.:..           |....|.:....|:.|        |..||..:|.. :|.
Human    47 SLVAKDGGTGGGTGG-----------GGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFV-SGF 99

  Fly   387 PRFSIAAAAAGMAQYLSQSQGAP------------LKTHAGHIVDRTHLYWP----GLQGLVANP 435
            |    ||||||..:.|   .|.|            |..|..|.:..:.|..|    |.|.  .:|
Human   100 P----AAAAAGAGRSL---YGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQH--RDP 155

  Fly   436 I---AWRERLSNTMSANLSQSHQHHPSN-DKDG---------KKKHTRPTFSGQQIFALEKTFEQ 487
            :   .|..|       |....|:...|: .:||         |.|..|..||..|:..||:.||:
Human   156 LHFYPWVLR-------NRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEK 213

  Fly   488 TKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAE 528
            ..|:.|.||.:||.:|.:||:||||||||||||::::...|
Human   214 NHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 14/65 (22%)
Homeobox 469..523 CDD:395001 29/53 (55%)
EMX1NP_004088.2 COG5576 140..>251 CDD:227863 43/119 (36%)
Homeobox 196..248 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.