DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and alr-1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:165 Identity:54/165 - (32%)
Similarity:77/165 - (46%) Gaps:34/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PRFSIAAAAAGMAQYLSQSQGAPLKTHAG-HIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANL 450
            |.|||||......: |.:..|.  ||..| :|::            .|:.:..||..|.:...| 
 Worm    59 PAFSIAALTNNQHE-LKEDDGK--KTPTGDNILE------------AASVLDNRENGSPSDGTN- 107

  Fly   451 SQSHQHHPSNDKDGKKKHT--RPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVW 513
                    |.|.:||:|..  |.|||..|:..|||.|.:|.|.....|.:||..:.::|::|:||
 Worm   108 --------SPDDNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVW 164

  Fly   514 FQNRRTKWRKRHAAEMATAKRKQDDM-----GGDN 543
            |||||.|:||:..:  :|....|..|     .|||
 Worm   165 FQNRRAKYRKQERS--STHHPYQAPMSIPNSNGDN 197

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity