DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx3-1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_035051.1 Gene:Nkx3-1 / 18095 MGIID:97352 Length:237 Species:Mus musculus


Alignment Length:156 Identity:49/156 - (31%)
Similarity:71/156 - (45%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 HAGHIVDRTHLYWP-----------GLQGLV-ANPIAWRERLSNTMSANLSQSH--------QHH 457
            |.||..:..|...|           |.:|:. .:|.:.|...:.|.:...|.:|        :|:
Mouse    46 HGGHSGNPQHSPDPRRDSAPEPDKAGGRGVAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHN 110

  Fly   458 PSNDKDG------KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQN 516
            |.:....      .:|.:|..||..|:..||:.|...|||:.||||.||..|.::|:|||:||||
Mouse   111 PGDLASAPQVTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQN 175

  Fly   517 RRTKWRKRHAAEMATAKRKQ--DDMG 540
            ||.|           .||||  :|:|
Mouse   176 RRYK-----------TKRKQLSEDLG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)
Nkx3-1NP_035051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 10/49 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..130 3/21 (14%)
Homeobox 128..181 CDD:278475 28/63 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.