DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx2-9

DIOPT Version :10

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:130 Identity:40/130 - (30%)
Similarity:60/130 - (46%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 QGLVANPIAWRE--------------RLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIF 479
            |..|....||.|              ..|...|:.|:...:..|.:|.: |::..|..||..|..
Mouse    31 QTCVPQTAAWLESECSHYLSSDESGLETSPADSSQLASLRRESPGSDPE-KRRKRRVLFSKAQTL 94

  Fly   480 ALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDND 544
            .||:.|.|.:||:.|||.:||..|.::.:|||:||||.|.|.::..|..:.    :..||...:|
Mouse    95 ELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGIT----EPSDMAASSD 155

  Fly   545  544
            Mouse   156  155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 26/57 (46%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 6/35 (17%)
Homeodomain 82..138 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.