DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Msx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:218 Identity:58/218 - (26%)
Similarity:85/218 - (38%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 GSGGSSSSSSTTTTNTNSQGAPNPHGIDTILS-KPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQ 400
            |.||:..|:.......:|.    |..::.::| |.||..|           |......|:||...
Mouse    27 GPGGAEGSAEERRVKVSSL----PFSVEALMSDKKPPKES-----------PAVPPDCASAGAVL 76

  Fly   401 YLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGK 465
                   .||.. .||.|...|     ..|.:..|.       .|.|.....|....|...:.|:
Mouse    77 -------RPLLL-PGHGVRDAH-----SPGPLVKPF-------ETASVKSENSEDGAPWIQEPGR 121

  Fly   466 ----KKHTRPT----------------FSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQV 510
                .:|..||                |:..|:.|||:.|.|.:||:..|||:.:.:|.::|:||
Mouse   122 YSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQV 186

  Fly   511 KVWFQNRRTKWRKRHAAEMATAK 533
            |:||||||.|.::...||:...|
Mouse   187 KIWFQNRRAKAKRLQEAELEKLK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 11/51 (22%)
Homeobox 469..523 CDD:395001 26/69 (38%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 4/27 (15%)
Homeobox 145..198 CDD:306543 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.