Sequence 1: | NP_001368954.1 | Gene: | HGTX / 53446 | FlyBaseID: | FBgn0040318 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369824.1 | Gene: | nob-1 / 176641 | WormBaseID: | WBGene00003779 | Length: | 243 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 56/212 - (26%) |
---|---|---|---|
Similarity: | 84/212 - (39%) | Gaps: | 54/212 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 340 GSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIA------------ 392
Fly 393 ------AAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVAN---PIAWRERLSNTMSA 448
Fly 449 NLSQSHQHHP-SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKV 512
Fly 513 WFQNRR---TKWRKRHA 526 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HGTX | NP_001368954.1 | ROM1 | 179..>388 | CDD:227709 | 11/47 (23%) |
Homeobox | 469..523 | CDD:395001 | 22/56 (39%) | ||
nob-1 | NP_001369824.1 | Homeobox | 165..219 | CDD:395001 | 22/55 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |