DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and egl-5

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001021166.1 Gene:egl-5 / 176093 WormBaseID:WBGene00001174 Length:223 Species:Caenorhabditis elegans


Alignment Length:233 Identity:57/233 - (24%)
Similarity:89/233 - (38%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GSSSSSSTTTTNTNSQGAPNPH-----GIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMA 399
            |||::||..|:.|:||...|.|     .:...:.|..|.||:..|          :.|:...|::
 Worm    11 GSSTASSAATSTTSSQPDANDHLSRLAAMTQGVGKEDPETSSTPS----------TEASLYPGIS 65

  Fly   400 QYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPI------AWRERLSNTMSANLSQSHQHHP 458
            ....||.|                 ||........|:      .|.:...||...|..:..    
 Worm    66 AAYMQSYG-----------------WPQNYNYFGQPLGPATFPGWPQCYPNTAWPNYGELF---- 109

  Fly   459 SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            ::.|.|     |.|:...|...||..|:|:.|::..:|.:|.....:::.|:|:||||||.|.:|
 Worm   110 ASSKKG-----RQTYQRYQTSVLEAKFQQSSYVSKKQREELRLQTQLTDRQIKIWFQNRRMKAKK 169

  Fly   524 RHAAEMATAKRKQDD---------------MGGDNDGD 546
            .        |::.||               ||.|.|.:
 Worm   170 E--------KQRVDDHTEHTPLLPANPPKGMGMDMDDE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 16/52 (31%)
Homeobox 469..523 CDD:395001 19/53 (36%)
egl-5NP_001021166.1 Homeobox 116..168 CDD:278475 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.