DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and ceh-43

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001338832.1 Gene:ceh-43 / 175581 WormBaseID:WBGene00000463 Length:282 Species:Caenorhabditis elegans


Alignment Length:234 Identity:68/234 - (29%)
Similarity:105/234 - (44%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 PVTSAGLSALTGAGI-PRF-------SIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGL 428
            |.||.|    .|:.: |.|       |....|.|.:.|     |.|.:|.|      ..:|.|| 
 Worm    22 PPTSNG----AGSNVSPYFPYHAYPTSSTNGATGGSMY-----GTPQQTSA------YAMYPPG- 70

  Fly   429 QGLVANP-IAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLA 492
            .|  ::| .|:.|..:..:.......:     |.|..|.:..|..::..|:..|:|.|::|:|||
 Worm    71 PG--SSPEEAFPEHTTTKIVEGCEAKY-----NVKGKKMRKPRTIYNSSQLQMLQKKFQKTQYLA 128

  Fly   493 GPERAKLAYALGMS---------ESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCS 548
            .|:||.||:.||:|         |.|||:||||||:|.:|:.......|..::||          
 Worm   129 LPDRAALAHELGLSQTQRAQPITEFQVKIWFQNRRSKQKKQKGGSSDHASDEEDD---------- 183

  Fly   549 ETMDSDNESLDMGES----PAQNKRCRSNSSGSSQQQQD 583
            :|.:|..||..||||    .:...|...:||..::.:::
 Worm   184 DTEESKPESPPMGESVMIQESSEPRTLVSSSIKTEMKEE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 5/16 (31%)
Homeobox 469..523 CDD:395001 28/62 (45%)
ceh-43NP_001338832.1 Homeobox 105..168 CDD:365835 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.