DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and cog-1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001022264.1 Gene:cog-1 / 175149 WormBaseID:WBGene00000584 Length:256 Species:Caenorhabditis elegans


Alignment Length:257 Identity:86/257 - (33%)
Similarity:120/257 - (46%) Gaps:65/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIP 387
            |.::|.::.|:..:.|..|.|||...:.::|.....:|....:.:..|...:|:..||.:...| 
 Worm    25 SSTYSISNLLLEKKESSPSGSSSEDDSASSNDDDQRSPSATSSFIFPPASSSSSSESATSPTQI- 88

  Fly   388 RFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGL------------VANPIAWRE 440
                      |||.::.          |..||      ||||..            :.|.:. :|
 Worm    89 ----------MAQLMAN----------GGAVD------PGLQAYFFLLQSQLNSQSMMNRVT-QE 126

  Fly   441 RLSNTMSA------------------NLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQ 487
            .:|..:::                  .|..|.|..| |..:.:||.:||||:|.||:.||:.|||
 Worm   127 NVSRALTSFNLLNNLPGALPSLSPMGRLQHSMQLSP-NSLNMQKKQSRPTFTGHQIYQLERKFEQ 190

  Fly   488 TKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDND-GDCS 548
            ||||||.:||:||..|.|||||||||||||||||||:.||:.|..||     |...| ..||
 Worm   191 TKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAADNALVKR-----GASGDKSPCS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 15/64 (23%)
Homeobox 469..523 CDD:395001 40/53 (75%)
cog-1NP_001022264.1 Homeobox 172..226 CDD:365835 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164554
Domainoid 1 1.000 93 1.000 Domainoid score I4796
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001882
OrthoInspector 1 1.000 - - oto18989
orthoMCL 1 0.900 - - OOG6_109928
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.