DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and DLX6

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_005213.3 Gene:DLX6 / 1750 HGNCID:2919 Length:293 Species:Homo sapiens


Alignment Length:328 Identity:78/328 - (23%)
Similarity:110/328 - (33%) Gaps:127/328 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 GVDSAKS----YALSQRSSGAEDPCQTSESASPPPQGQNDYSPENLSSQRAKFQHHHGVNPL-AL 266
            |.||:||    :...|:....:...|..:...|||.......|.:..|..|....|:   || .|
Human    13 GQDSSKSAFMEFGQQQQQQQQQQQQQQQQQQQPPPPPPPPPQPHSQQSSPAMAGAHY---PLHCL 74

  Fly   267 HNANHAGNPGCHNNNNHMDHKLPLSFLGPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSP--- 328
            |:|..|...|.|::::|..|              |.          |...||..|.||:|..   
Human    75 HSAAAAAAAGSHHHHHHQHH--------------HH----------GSPYASGGGNSYNHRSLAA 115

  Fly   329 ---NSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFS 390
               .||          |..|....:..||..|....|.||...|...:.:         |..|| 
Human   116 YPYMSH----------SQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIEN---------GEIRF- 160

  Fly   391 IAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQ 455
                                                                             
Human   161 ----------------------------------------------------------------- 160

  Fly   456 HHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTK 520
                |.|..|.:..|..:|..|:.||...|:||:|||.||||:||.:||::::|||:||||:|:|
Human   161 ----NGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSK 221

  Fly   521 WRK 523
            ::|
Human   222 FKK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 44/191 (23%)
Homeobox 469..523 CDD:395001 28/53 (53%)
DLX6NP_005213.3 COG5576 119..>231 CDD:227863 46/195 (24%)
Homeobox 170..223 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.