DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and DLX1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_835221.2 Gene:DLX1 / 1745 HGNCID:2914 Length:255 Species:Homo sapiens


Alignment Length:193 Identity:60/193 - (31%)
Similarity:93/193 - (48%) Gaps:56/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 NSQGAPNP--HGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAP----LK 411
            |.|.:|:|  ||..::..    :.|||.|...||    :|.|::       .|:..|.|    :.
Human    27 NQQMSPSPMSHGHYSMHC----LHSAGHSQPDGA----YSSASS-------FSRPLGYPYVNSVS 76

  Fly   412 THAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKD------------- 463
            :||......:...:||                   ||:|:||....|..|.:             
Human    77 SHASSPYISSVQSYPG-------------------SASLAQSRLEDPGADSEKSTVVEGGEVRFN 122

  Fly   464 --GKK-KHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
              ||| :..|..:|..|:.||.:.|:||:|||.||||:||.:||::::|||:||||:|:|::|
Human   123 GKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 12/36 (33%)
Homeobox 469..523 CDD:395001 28/53 (53%)
DLX1NP_835221.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 5/22 (23%)
Homeobox 131..185 CDD:395001 28/53 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.