DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and ceh-7

DIOPT Version :10

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_495848.1 Gene:ceh-7 / 174391 WormBaseID:WBGene00000432 Length:84 Species:Caenorhabditis elegans


Alignment Length:54 Identity:25/54 - (46%)
Similarity:37/54 - (68%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 RPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            |.||:.:|::.||..|.|::|:...||.:||..|.:.|.|||:||||||.:.|:
 Worm    27 RTTFTVEQLYLLEMYFAQSQYVGCDERERLARILSLDEYQVKIWFQNRRIRMRR 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 24/52 (46%)
ceh-7NP_495848.1 Homeodomain 25..80 CDD:459649 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.