DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Hoxa6

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:224 Identity:53/224 - (23%)
Similarity:82/224 - (36%) Gaps:62/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 SSASANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLS 379
            |..:.|..||.:.. |...||:...|:|.|.:      |.|..|                     
Mouse    63 SVLACNRASYEYGA-SCFYSDKDLSGASPSGN------NKQRGP--------------------- 99

  Fly   380 ALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPI-AWRERLS 443
                               ..||..|.....|....  |....|:..|......:|: .|.:|::
Mouse   100 -------------------GDYLHFSPEQQYKPDGS--VQGKALHEEGTDRKYTSPVYPWMQRMN 143

  Fly   444 NTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSES 508
            :...|       .:.|:.:.|::.:||     .|...|||.|...:||....|.::|.||.::|.
Mouse   144 SCAGA-------VYGSHGRRGRQTYTR-----YQTLELEKEFHFNRYLTRRRRIEIANALCLTER 196

  Fly   509 QVKVWFQNRRTKWRKRHAAEMATAKRKQD 537
            |:|:||||||.||:|.:....:|....:|
Mouse   197 QIKIWFQNRRMKWKKENKLINSTQASGED 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 13/72 (18%)
Homeobox 469..523 CDD:395001 24/53 (45%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 11/85 (13%)
Antp-type hexapeptide 135..140 1/4 (25%)
Homeobox 158..210 CDD:278475 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.