DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx5

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:227 Identity:61/227 - (26%)
Similarity:100/227 - (44%) Gaps:50/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 SSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAP 409
            ||.|.::..|.....|||..:      |.:::...||.........:..:|||.          |
Mouse    40 SSATDSDYYSPAGAAPHGYCS------PTSASYGKALNPYQYQYHGVNGSAAGY----------P 88

  Fly   410 LKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQH--HPS----NDKDGKKKH 468
            .|.:|.:             | .|:|........|.:.:..||..:.  .|.    |.|..|.:.
Mouse    89 AKAYADY-------------G-YASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRK 139

  Fly   469 TRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAK 533
            .|..:|..|:.||::.|::|:|||.||||:||.:||::::|||:||||:|:|.:|         .
Mouse   140 PRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKK---------I 195

  Fly   534 RKQDDMGGDNDGDCSETMDSDNESLDMGESPA 565
            .|..:|..::....|:.|     :.:..:|||
Mouse   196 MKNGEMPPEHSPSSSDPM-----ACNSPQSPA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 10/42 (24%)
Homeobox 469..523 CDD:395001 27/53 (51%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 3/8 (38%)
DLL_N 32..118 CDD:403572 21/107 (20%)
Homeobox 140..194 CDD:395001 27/53 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.