DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx4

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:193 Identity:60/193 - (31%)
Similarity:92/193 - (47%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 SKPPPVTSAGLSALTGAGI-PRFSIAAA---------AAGMAQYLSQSQGAPLK-THAGHIVDRT 421
            |.|.|:...|.|.:....: |..|:.||         ||......|||.|.|.. :|.|......
Mouse     3 SLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGD 67

  Fly   422 HLYWPGLQGLVA------NPIAWRERL---SNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQ 477
            . |.|..|.|||      .|....:.|   |..::.:|..|.|...:.    |.:..|..:|..|
Mouse    68 S-YLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTR----KLRKPRTIYSSLQ 127

  Fly   478 IFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMG 540
            :..|.:.|:.|:|||.||||:||..||::::|||:||||:|:|::|  ..:.::.:.::|..|
Mouse   128 LQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK--LLKQSSGEPEEDFSG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 5/20 (25%)
Homeobox 469..523 CDD:395001 26/53 (49%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 7/26 (27%)
Homeobox 119..172 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.