DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Dlx3

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034185.1 Gene:Dlx3 / 13393 MGIID:94903 Length:287 Species:Mus musculus


Alignment Length:266 Identity:66/266 - (24%)
Similarity:112/266 - (42%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 NSHLISDRGSGGSSSSSSTTTTNTNSQGAP-------NPHGIDTILSKPPPVT---SAGLSALTG 383
            :|.|....||..|.:...:|.|:.....||       .|:| .|:    .|.|   ...|:.|.|
Mouse    17 SSSLSCHAGSKDSPTLPESTVTDLGYYSAPQHDYYSGQPYG-QTV----NPYTYHHQFNLNGLAG 76

  Fly   384 AGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSA 448
            .|        |.:..::|   :.|...:.:.                      |:||:   .:.|
Mouse    77 TG--------AYSPKSEY---TYGGSYRQYG----------------------AYREQ---PLPA 105

  Fly   449 NLSQSHQHHPS------NDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSE 507
            ....|.:..|.      |.|..|.:..|..:|..|:.||::.|::.:|||.||||:||..||:::
Mouse   106 QDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQ 170

  Fly   508 SQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMGGDNDGDCSETM-----------DSDNESLDMG 561
            :|||:||||||:|::|.:         |..::..::..:.|::|           |:.:.|.   
Mouse   171 TQVKIWFQNRRSKFKKLY---------KNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHST--- 223

  Fly   562 ESPAQN 567
            .:||:|
Mouse   224 PAPARN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 18/68 (26%)
Homeobox 469..523 CDD:395001 27/53 (51%)
Dlx3NP_034185.1 DLL_N 27..107 CDD:315147 21/120 (18%)
Abdominal-A <109..224 CDD:332641 38/126 (30%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:O60479 131..181 24/49 (49%)
Homeobox 132..185 CDD:306543 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.